PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.D1IDL
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family ARR-B
Protein Properties Length: 579aa    MW: 64997.6 Da    PI: 5.994
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.D1IDLgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like772.4e-24202255155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  k+r++W+ +LH++Fv+av+q+ G +k  Pk+il+lm+v+ Lt+e+v+SHLQkYRl
  Araip.D1IDL 202 KARVVWSVDLHQKFVKAVNQI-GFDKVGPKKILDLMNVPWLTRENVASHLQKYRL 255
                  68*******************.9*******************************8 PP

2Response_reg80.94e-27221301109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl+vdD+p+ +++l+++l+k  y ev+++  ++ al+ll+e++  +D+++ D++mp+mdG++ll++   e  +lp+i+++  ge + + + ++ Ga 
   Araip.D1IDL  22 VLVVDDDPTWLRILEKMLKKCSY-EVTTCCLARHALHLLRERKdgYDIVISDVNMPDMDGFKLLEHVGLEM-DLPVIMMSVDGETSRVMKGVQHGAC 116
                   89*********************.***************999999**********************6644.8************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   d+l Kp+ ++el++
   Araip.D1IDL 117 DYLLKPIRMKELRN 130
                   ***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521724.7E-3519148IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23008.6E-4419169No hitNo description
SMARTSM004481.3E-3120132IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.17721136IPR001789Signal transduction response regulator, receiver domain
PfamPF000722.7E-2422131IPR001789Signal transduction response regulator, receiver domain
CDDcd001565.81E-2923136No hitNo description
Gene3DG3DSA:1.10.10.607.7E-28200260IPR009057Homeodomain-like
SuperFamilySSF466894.12E-17200259IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-21202255IPR006447Myb domain, plants
PfamPF002491.8E-7204254IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0009735Biological Processresponse to cytokinin
GO:0010082Biological Processregulation of root meristem growth
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 579 aa     Download sequence    Send to blast
MDNNNGCFSS PRRDAFPAGL RVLVVDDDPT WLRILEKMLK KCSYEVTTCC LARHALHLLR  60
ERKDGYDIVI SDVNMPDMDG FKLLEHVGLE MDLPVIMMSV DGETSRVMKG VQHGACDYLL  120
KPIRMKELRN IWQHVFRKRI HEAREFESFE GFESIHLMRN GLEQCDDGNL FALEDMTSTK  180
KRKDADNKHD DRELIDPSST KKARVVWSVD LHQKFVKAVN QIGFDKVGPK KILDLMNVPW  240
LTRENVASHL QKYRLYLSRL QKENDLKSHS IGMNSDLAST DLGSLVGVQN SGSKKQNDVS  300
IDSCSYSEGA LQLQNLETKT HEGSSDPNGT ISPPATTEKG RTMIRNFVSE KKMRKNQPFD  360
SLEPEGNHTA VIDCSIPTQF SWNEVPEIQL KDHKPLVQLE GNLSHKFPVT GKKHQIQVDH  420
QSPSIGSISS PSLTGEEVTA CIKTKPLCAD YKCEYKSSVS SIGSAVDNNT FPIEPGSLMM  480
NDPSTAPIST TNLGLKTQAS NLNSISDMEF CQRNLLLDAV SLPLDDDLHF NWLHGECSNI  540
NFSLQNIGYY DPGLIAEIPT HYYDSAADYS VIDQGLFIS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-17198260163ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00010PBMTransfer from AT1G67710Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016180981.10.0PREDICTED: two-component response regulator ARR11-like
TrEMBLA0A0B2QVM40.0A0A0B2QVM4_GLYSO; Two-component response regulator ARR11
STRINGGLYMA11G37480.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39993360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67710.11e-113response regulator 11